Introduction from Drug peptide supply about Apraglutide/1295353-98-8 English name Apraglutide Supplier Remetide CAS NO 1295353-98-8 Peptide sequence Molecular formula Molecular weight storage temperature 2-8℃ purity ≥98% Package 1mg;5mg;10mg;50mg;100mg,1g or according to customer’s detail requirement. Product English synonyms Interested? Please contact us: Hot line:+1 (626)376-9758 Email:amin@remetide.com
Introduction from Drug peptide supply about sGnRH-A/96497-82-4 English name sGnRH-A Supplier Remetide CAS NO 96497-82-4 Peptide sequence Glp-His-Trp-Ser-Tyr-DArg-Trp-Leu-Pro-NHEt Molecular formula C64H83N17O12 Molecular weight 1282.5 storage temperature 2-8℃ purity ≥98% Package 1mg;5mg;10mg;50mg;100mg,1g or according to customer’s detail requirement. Product English synonyms (Des-Gly10,D-Arg6,Pro-NHEt9)-LHRH(salmon)；L-Prolinamide,5-oxo-L-prolyl-L-histidyl-L-tryptophyl-L-seryl-L-tyrosyl-D-arginyl-L-tryptophyl-L-leucyl-N-ethyl-;D-Arg6,Pro9-NEt]SalmonGnRH Want to purchase? Hot line:+1 (626)376-9758 Email:amin@remetide.com
Introduction from Drug peptide supply about Acetyl-α-MSH (11-13)/57899-96-4 English name Acetyl-α-MSH (11-13) Supplier Remetide CAS NO 57899-96-4 Peptide sequence Ac-Lys-Pro-Val-NH2 Molecular formula C18H33N5O4 Molecular weight 383.5 storage temperature 2-8℃ purity ≥98% Package 1mg;5mg;10mg;50mg;100mg,1g or according to customer’s detail requirement. Product English synonyms (S)-1-((S)-2-Acetamido-6-aminohexanoyl)-N-((S)-1-amino-3-methyl-1-oxobutan-2-yl)pyrrolidine-2-carboxamide Interested? Please contact us: Hot line:+1 (626)376-9758 Email:amin@remetide.com
Introduction from Drug peptide supply about N-acetyl Selank Amidate English name N-acetyl Selank Amidate Chinese name CAS NO Peptide sequence Ac-Thr-Lys-Pro-Arg-Pro-Gly-Pro-NH2 Molecular formula C35H60N12O9 Molecular weight 792.9 storage temperature 2-8℃ purity ≥98% Package 1mg;5mg;10mg;50mg;100mg,1g or according to customer’s detail requirement. Product English synonyms How to buy N-acetyl Selank Amidate in the U. S. Remetide Peptide Supplier specializes in the production and sales of drug peptides in the USA, as well as professional drug peptide R&D. Feel free to contact us if you have any questions or inquiries about N-acetyl Selank Amidate Peptides.
Introduction from Drug peptide supply about Thymopentin/Thyopentin/69558-55-0 English name Thymopentin Chinese name 胸腺五肽 CAS NO 69558-55-0 Peptide sequence Arg-Lys-Asp-Val-Tyr Molecular formula C30H49N9O9 Molecular weight 679.8 storage temperature 2-8℃ purity ≥98% Package 1mg;5mg;10mg;50mg;100mg,1g or according to customer’s detail requirement. Product English synonyms Thyopentin;Thymopent njection;Thymopoietin II-(32-36);TP-5 What is Thymopentin? Thymopentin, referred to as TP5, is a very important immune-promoting active polypeptide drug, which can significantly improve human immunity, help humans effectively resist a variety of diseases, and at the same time have a significant and definite curative effect on a variety of diseases, with
Introduction from Drug peptide supply about GRF (1-44) (HUMAN)/GRF (human)/83930-13-6 English name GRF (1-44) (HUMAN) Chinese name 生长激素释放因子 (1-44) CAS NO 83930-13-6 Peptide sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg- Molecular formula C215H358N72O66S1 Molecular weight 5039.7 storage temperature 2-8℃ purity ≥98% Package 1mg;5mg;10mg;50mg;100mg,1g or according to customer’s detail requirement. Product English synonyms SOMATOCRININ(HUMAN);SOMATOLIBERIN(HUMAN);YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2;GRF(huMan)SoMatoliberin(huMan),rowthHorMone-ReleasingFactor(huMan),GrowthHorMone-ReleasingHorMone(huMan),GHRH(huMan),SoMatorelin What is GRF (human)? GRF (human) is a hypothalamic polypeptide that stimulates the production and release of growth hormone by binding to the growth hormone-releasing hormone receptor (GHRHR) on prepituitary cells. How to buy GRF (1-44) (HUMAN) in the U. S. Remetide Peptide Supplier
Introduction from Drug peptide supply about Angiotensin III/ANGIOTENSIN III ACETATE/13602-53-4 English name Angiotensin III Chinese name 血管紧张素III CAS NO 13602-53-4 Peptide sequence Arg-Val-Tyr-Ile-His-Pro-Phe Molecular formula C46H66N12O9 Molecular weight 931.09 storage temperature 2-8℃ purity ≥98% Package 1mg;5mg;10mg;50mg;100mg,1g or according to customer’s detail requirement. Product English synonyms ANGIOTENSIN III ACETATE SALT What is Angiotensin III? Angiotensin III, human, mouse is a heptapeptide that is an angiotensin type 2 receptor (AT2R) agonist with IC50 values of 0.648 nM and 21.1 nM for AT2R and AT1R, respectively. How to buy Angiotensin III in the U.
Introduction from Drug peptide supply about Vosoritide/Vosoritide acetate/1480724-61-5 English name Vosoritide Chinese name 伏索利肽 CAS NO 1480724-61-5 Peptide sequence Pro-Gly-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys(Cys23&Cys39 bridge) Molecular formula C176H290N56O51S3 Molecular weight 4102.8 storage temperature 2-8℃ purity ≥98% Package 1mg;5mg;10mg;50mg;100mg,1g or according to customer’s detail requirement. Product English synonyms Vosoritide acetate How to buy Vosoritide in the U. S. Remetide Peptide Supplier specializes in the production and sales of peptides in the USA, as well as professional peptide R&D. Feel free to contact us if you have any questions or inquiries about Vosoritide Peptides. Hot line:+19498788363 Wechat:americhina Email:amin@remetide.com
Introduction from Drug peptide supply about Angiotensin I, human/70937-97-2/484-42-4 English name Angiotensin I, human Chinese name 血管紧张肽I CAS NO 70937-97-2/484-42-4 Peptide sequence Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu Molecular formula C62H89N17O14 Molecular weight 1296.5 storage temperature 2-8℃ purity ≥98% Package 1mg;5mg;10mg;50mg;100mg,1g or according to customer’s detail requirement. Product English synonyms AngiotensinI, diacetate; ANGIOTENSINIACETATE, HUMAN; ANGIOTENSINIHUMANACETATEHYDRATE; AngiotensinIhumanacetatesalthydrate How to buy Angiotensin I, human in the U. S. Remetide Peptide Supplier specializes in the production and sales of peptides in the USA, as well as professional peptide R&D. Feel free to contact us if you have any
Introduction from Drug peptide supply about α-MSH(11-13)/67727-97-3 English name α-MSH(11-13) Chinese name ALPHA-促黑细胞激素(11-13) CAS NO 67727-97-3 Peptide sequence Lys-Pro-Val Molecular formula C16H30N4O4 Molecular weight 342.43 storage temperature 2-8℃ purity ≥98% Package 1mg;5mg;10mg;50mg;100mg,1g or according to customer’s detail requirement. Product English synonyms α-Melanotropin(11-13);α-Melanotropin(11-13)[human];α-Melanotropin(11-13)[pig];α-MSH(11-13)[human];a-MSH (11-13) (free acid) How to buy α-MSH(11-13) in the U. S. Remetide Peptide Supplier specializes in the production and sales of peptides in the USA, as well as professional peptide R&D. Feel free to contact us if you have any questions or inquiries about α-MSH(11-13) Peptides. Hot
Introduction from Drug peptide supply about PASIREOTIDE/396091-73-9 English name PASIREOTIDE Chinese name 帕瑞肽 CAS NO 396091-73-9 Peptide sequence Cyclo[Hyp(2-aminoethylcarboxyl)-Phg-DTrp-Lys-Tyr(Bzl)-Phe] Molecular formula C58H66N10O9 Molecular weight 1047.23 storage temperature 2-8℃ purity ≥98% Package 1mg;5mg;10mg;50mg;100mg,1g or according to customer’s detail requirement. Product English synonyms Cyclo[(2S)-2-phenylglycyl-D-tryptophyl-L-lysyl-O-(phenylmethyl)-L-tyrosyl-L-phenylalanyl-(4R)-4-[[[(2-aminoethyl)amino]carbonyl]oxy]-L-prolyl];SOM320;[(3S,6S,9S,12R,15S,18S,20R)-9-(4-aminobutyl)-3-benzyl-12-(1H-indol-3-ylmethyl)-2,5,8,11,14,17-hexaoxo-15-phenyl-6-[(4-phenylmethoxyphenyl)methyl]-1,4,7,10,13,16-hexazabicyclo[16.3.0]henicosan-20-yl]N-(2-aminoethyl)carbamate Pasireotide overview Pasireotide bis-aspartate, is a growth hormone inhibitor analog, in the study of growth hormone (GH) releasing factor, in the experiment of distribution in the hypothalamus of mice, a peptide that can inhibit the release of GH was accidentally discovered , this peptide is named somatostatin (SS), which
Introduction from Drug peptide supply about Dulaglutide/923950-08-7 English name Dulaglutide Chinese name 杜拉鲁肽 CAS NO 923950-08-7 Peptide sequence His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly Molecular formula C149H221N37O49 Molecular weight 3314.6 storage temperature 2-8℃ purity ≥98% Package 1mg;5mg;10mg;50mg;100mg,1g or according to customer’s detail requirement. Product English synonyms What is Dulaglutide? The GLP analog dulaglutide, a long-acting GLP-1 analog, was approved in the United States in September 2014 for the treatment of type 2 diabetes. Structurally, Dulaglutide replaces Ala with Gly at position 8 on the GLP-1 (7-37) chain, Glu at position 22 for Gly, and Gly at
Introduction from Drug peptide supply about Teduglutide/ALX 0600/197922-42-2 English name Teduglutide Chinese name 替度鲁肽 CAS NO 197922-42-2 Peptide sequence His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp Molecular formula C164H252N44O55S Molecular weight 3752.08248 storage temperature 2-8℃ purity ≥98% Package 1mg;5mg;10mg;50mg;100mg,1g or according to customer’s detail requirement. Product English synonyms ALX 0600;Gattex;Glucagon-like peptide II [2-glycine] (human) What is Teduglutide? Teduglutide, a glucagon-like peptide 2 (GLP-2) analog, is a naturally occurring hormone that reduces gastric emptying and secretion and regulates the growth, proliferation, and repair of small intestinal lining cells. The drug increases the number of these cells, which increase
Introduction from Drug peptide supply about DOTA-(Tyr3)-Octreotate/177943-89-4 English name DOTA-(Tyr3)-Octreotate Chinese name DOTA-3-酪氨酰基-奥曲肽 CAS NO 177943-89-4 Peptide sequence DOTA-DPhe-CY-DTrp-KTCT(Cys3&Cys8 bridge) Molecular formula C67H94N14O21S2 Molecular weight 1495.69 storage temperature 2-8℃ purity ≥98% Package 1mg;5mg;10mg;50mg;100mg,1g or according to customer’s detail requirement. Product English synonyms DOTA-(TYR3,THR8)-OCTREOTIDE ACETATE;L-Threonine,N-[[4,7,10-tris(carboxymethyl)-1,4,7,10-tetraazacyclododec-1-yl]acetyl]-Dphenylalanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-threonyl-L-cysteinyl-,cyclic(2)-disulfide,acetate(salt)(9CI);S-2-(4-Isothiocyanatobenzyl)-1,4,7,10-tetraaza-1,4,7,10-tetra(2-carbamoylmethyl)cyclododecane What is DOTA-(Tyr3)-Octreotate? DOTA-(Tyr3)-Octreotate is a DOTA-conjugated peptide that can be radionuclide-labeled for positron emission tomography (PET) imaging and peptide receptor radionuclide therapy (PRRT). How to buy DOTA-(Tyr3)-Octreotate in the U. S. Remetide Peptide Supplier specializes in the production and sales of peptides in the USA, as well
Introduction from Drug peptide supply about ACTH (4-10)/4037-01-8 English name ACTH (4-10) Chinese name 人ACTH (4-10)肽 CAS NO 4037-01-8 Peptide sequence Met-Glu-His-Phe-Arg-Trp-Gly Molecular formula C44H59N13O10S1 Molecular weight 962.1 storage temperature 2-8℃ purity ≥98% Package 1mg;5mg;10mg;50mg;100mg,1g or according to customer’s detail requirement. Product English synonyms ADRENOCORTICOTROPICHORMONEFRAGMENT4-10;ACTH(4-10),HUMAN Biological activity of ACTH (4-10) ACTH (4-10) is a potent melanocortin 4 receptor (MC4R) agonist. How to buy ACTH (4-10) in the U. S. Remetide Peptide Supplier specializes in the production and sales of peptides in the USA, as well as professional peptide R&D. Feel free
Introduction from Drug peptide supply about Epobis English name Epobis Chinese name CAS NO Peptide sequence Asn-Glu-Asn-Ile-Thr-Val-Pro-Asp-Thr-Lys-Val-Asn-Phe-Tyr-Ala-Trp-Lys-Arg Molecular formula C100H151N27O29 Molecular weight 2195.5 storage temperature 2-8℃ purity ≥98% Package 1mg;5mg;10mg;50mg;100mg,1g or according to customer’s detail requirement. Product English synonyms How to buy Epobis Peptides in the U. S. Remetide Peptide Supplier specializes in the production and sales of peptides in the USA, as well as professional peptide R&D. Feel free to contact us if you have any questions or inquiries about Epobis Peptides. Hot line:+19498788363 Wechat:americhina Email:amin@remetide.com
Introduction from Drug peptide supply about Adipotide English name Adipotide Chinese name CAS NO Peptide sequence Cys-Lys-Gly-Gly-Arg-Ala-Lys-Asp-Cys-Gly-Gly-DLys-DLeu-DAla-DLys-DLeu-DAla-DLys-DLys-DLeu-DAla-DLys-DLeu-DAla-DLys(Cys1&Cys9 bridge) Molecular formula C111H204N36O28S2 Molecular weight 2555.2 storage temperature 2-8℃ purity ≥98% Package 1mg;5mg;10mg;50mg;100mg,1g or according to customer’s detail requirement. Product English synonyms How to buy Adipotide in the U. S. Remetide Peptide Supplier specializes in the production and sales of peptides in the USA, as well as professional peptide R&D. Feel free to contact us if you have any questions or inquiries about Adipotide Peptides. Hot line:+19498788363 Wechat:americhina Email:amin@remetide.com
Introduction from Drug peptide supply about Ornipressin/Ornipressin Acetate/3397-23-7 English name Ornipressin Chinese name 鸟氨酸加压素 CAS NO 3397-23-7 Peptide sequence Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Orn-Gly-NH2（Cys&Cys bridge） Molecular formula C45H63N13O12S2 Molecular weight 1042.2 storage temperature 2-8℃ purity ≥98% Package 1mg;5mg;10mg;50mg;100mg,1g or according to customer’s detail requirement. Product English synonyms Ornipressin Acetate;1-[19-Amino-13-benzyl-10-(2-carbamoylethyl)-7-(carbamoylmethyl)-16-[(4-hydroxyphenyl)methyl]-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentazacycloicosane-4-carbonyl]-N-[4-amino-1-(carbamoylmethylcarbamoyl)butyl]pyrrolidine-2-carboxamide;8-Ornithinevasopressin;OVASOPRESSIN,8-L-ORNITHINE-;POR-8 What is Ornipressin? Ornipressin is a potent vasoconstrictor, hemostatic and renal drug. Use of Ornipressin Ornipressin can be clinically used for hemostasis in various surgical procedures and can be used simultaneously with halothane. Ornipressin in the treatment of decompensated hepatorenal syndrome in cirrhosis – acting on
Remetide Global is a global peptide products manufacturer and distributor, supplying high quality special peptide agents for worldwide life science research and development community. Remetide does not encourage any use beyond labelled uses and will not be responsible for any misuse of its products.